Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0716 protein fxsA (fxsA)

This Recombinant UPF0716 protein fxsA (fxsA) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

UPF0716 protein fxsA, Suppressor of F exclusion of phage T7

UniProt

P37148

Expression Region

1-139

Origin

Serratia marcescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWLPLLLIFLLAYIEISIFIKVAAVLGVAVTLLLVVFSSCVGISLVRNQGMKTFVQMQQ KLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPVQKSLTLKLMPHLSVYR PGGWTGGDAANGNTFDGEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFXANK (NM_003721) Human Recombinant Protein
TP320744L 1 mg

RFXANK (NM_003721) Human Recombinant Protein

Sign In for Pricing
View Details
ReadiLink™ Cy3 Nick Translation dsDNA Labeling Kit
17406-AAT 10 Reactions

ReadiLink™ Cy3 Nick Translation dsDNA Labeling Kit

Sign In for Pricing
View Details
4-Nitrophenyl Isocyanate (1-Isocyanato-4-nitrobenzene)
TRC-I798270-25G 25 g

4-Nitrophenyl Isocyanate (1-Isocyanato-4-nitrobenzene)

Sign In for Pricing
View Details
Tide Fluor™ 6WS azide [TF6WS azide]
2302-AAT 1 mg

Tide Fluor™ 6WS azide [TF6WS azide]

Sign In for Pricing
View Details
CysLT1 (CYSLTR1) Rabbit Polyclonal Antibody
AP01264PU-N 100 µg

CysLT1 (CYSLTR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-01 24 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details