Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0716 protein fxsA (fxsA)

This Recombinant UPF0716 protein fxsA (fxsA) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

UPF0716 protein fxsA, Suppressor of F exclusion of phage T7

UniProt

P37148

Expression Region

1-139

Origin

Serratia marcescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWLPLLLIFLLAYIEISIFIKVAAVLGVAVTLLLVVFSSCVGISLVRNQGMKTFVQMQQ KLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPVQKSLTLKLMPHLSVYR PGGWTGGDAANGNTFDGEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Naa60 activation kit by CRISPRa
GA210010 1 Kit

Mouse Naa60 activation kit by CRISPRa

Sign In for Pricing
View Details
MTH1 (NUDT1) (NM_198950) Human Recombinant Protein
TP312761 20 µg

MTH1 (NUDT1) (NM_198950) Human Recombinant Protein

Sign In for Pricing
View Details
PAX7 Mouse Monoclonal Antibody [Clone ID: OTI4A7]
CF811661 100 µg

PAX7 Mouse Monoclonal Antibody [Clone ID: OTI4A7]

Sign In for Pricing
View Details
OR51S1 (C-term) Rabbit Polyclonal Antibody
AP53074PU-N 400 µL

OR51S1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD3D & CD3E Heterodimer Protein
PKSM040323 50 µg

Recombinant Mouse CD3D & CD3E Heterodimer Protein

Sign In for Pricing
View Details
LTK Rabbit Monoclonal Antibody [Clone ID: R02-8A4]
TA421720 100 µL

LTK Rabbit Monoclonal Antibody [Clone ID: R02-8A4]

Sign In for Pricing
View Details