Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Malaria protein EXP-1 (EXP-1)

This Recombinant Malaria protein EXP-1 (EXP-1) spans the amino acid sequence from region 23-162.

Product Specifications

Product Name Alternative

Malaria protein EXP-1, Exported antigen AG 5.1

UniProt

P04926

Expression Region

23-162

Origin

Plasmodium falciparum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EKTNKETGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSVLA GLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNADPQVTAQ DVTPEQPQGDDNNLVSGPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AMMECR1 Antibody [HRP]
NBP2-97342H 0.1 mL

Rabbit Polyclonal AMMECR1 Antibody [HRP]

Sign In for Pricing
View Details
UBA3 Recombinant Antibody, HRP Conjugated
bsm-62623R-HRP 100 µL

UBA3 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Cy7.5, NHS Ester
CHM-252-1mg 1 mg

Cy7.5, NHS Ester

Sign In for Pricing
View Details
Mouse Monoclonal CCR4 Antibody (205410) [DyLight 650]
FAB1567W 0.1 mL

Mouse Monoclonal CCR4 Antibody (205410) [DyLight 650]

Sign In for Pricing
View Details
OR4X1 Antibody
ABD5098 100 µg

OR4X1 Antibody

Sign In for Pricing
View Details
Olr875 CRISPRa sgRNA lentivector (set of three targets)(Rat)
34756126 3x 1.0µg DNA

Olr875 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details