Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Malaria protein EXP-1 (EXP-1)

This Recombinant Malaria protein EXP-1 (EXP-1) spans the amino acid sequence from region 23-162.

Product Specifications

Product Name Alternative

Malaria protein EXP-1, Exported antigen AG 5.1

UniProt

P04926

Expression Region

23-162

Origin

Plasmodium falciparum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EKTNKETGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSVLA GLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNADPQVTAQ DVTPEQPQGDDNNLVSGPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (LN-1) - Azide and BSA Free
NBP2-47890-0.1mg 0.1 mg

Mouse Monoclonal ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (LN-1) - Azide and BSA Free

Sign In for Pricing
View Details
Recombinant Treponema Pallidum rplJ Protein (aa 1-180) (strain SS14)
VAng-Cr1237-1mgEcoli 1 mg (E. coli)

Recombinant Treponema Pallidum rplJ Protein (aa 1-180) (strain SS14)

Sign In for Pricing
View Details
SLC16A8 Peptide
DF13644-BP 1 mg

SLC16A8 Peptide

Sign In for Pricing
View Details
Glycogen Synthase Kinase 3 β (GSK3β) Rat ELISA Kit
95659 96 Tests

Glycogen Synthase Kinase 3 β (GSK3β) Rat ELISA Kit

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Thymidylate kinase (tmk)
MBS1356899-01 0.02 mg (E-Coli)

Recombinant Protochlamydia amoebophila Thymidylate kinase (tmk)

Sign In for Pricing
View Details
Recombinant Protochlamydia amoebophila Thymidylate kinase (tmk)
MBS1356899-02 0.1 mg (E-Coli)

Recombinant Protochlamydia amoebophila Thymidylate kinase (tmk)

Sign In for Pricing
View Details