Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas oryzae pv. oryzae Large-conductance mechanosensitive channel (mscL)

This Recombinant Xanthomonas oryzae pv. oryzae Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B2SWL6

Expression Region

1-140

Origin

Xanthomonas oryzae pv. oryzae (strain PXO99A)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMVSEFKQFAIRGNVIDLAVGVVIGAAFGKIVTALVEKIIMPPIGWAIGNVDFSRLAWV LKPAGVDATGKDIPAVAIGYGDFINTVVQFVIIAFAIFLLVKLINRVTNRKPDAPKGPSE EVLLLREIRDSLKNDTLKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-100 1x 100 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/839), CF568 conjugate, 0.1mg/mL
BNC680839-100 1x 100 µL

CD43 (SPN/839), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details