Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.04 (SPCC622.04)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.04 (SPCC622.04) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein C622.04

UniProt

O94594

Expression Region

1-140

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQPDIEIVIKEDFTYRECSDVANDVFKKTQWLLYVFLFIIFANCVVDVKYYFEGFSHSL LFVYFFLTLIILLVSFMGFHYLNSIPKPEAEPDYRKKQESKNQDFLKSQSNEPLEYASSS AVELEKEKNTREGLTILESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP1 HDR Plasmid (h)
sc-401293-HDR 20 µg

FBP1 HDR Plasmid (h)

Sign In for Pricing
View Details
COBRA1, ID (COBRA1, KIAA1182, NELFB, Negative elongation factor B, Cofactor of BRCA1) (AP) discontinued
034069-AP 200 µL

COBRA1, ID (COBRA1, KIAA1182, NELFB, Negative elongation factor B, Cofactor of BRCA1) (AP) discontinued

Sign In for Pricing
View Details
SUS6 Antibody
orb797415 2 mg

SUS6 Antibody

Sign In for Pricing
View Details
Anti-Mouse I-Ad, FITC (Clone 34-5-3S) (mouse IgG2a)
MBS520356-01 0.1 mg

Anti-Mouse I-Ad, FITC (Clone 34-5-3S) (mouse IgG2a)

Sign In for Pricing
View Details
Anti-Mouse I-Ad, FITC (Clone 34-5-3S) (mouse IgG2a)
MBS520356-02 5x 0.1 mg

Anti-Mouse I-Ad, FITC (Clone 34-5-3S) (mouse IgG2a)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C23H4.13c (SPAC23H4.13c)
MBS7040234-01 0.02 mg

Recombinant Schizosaccharomyces pombe Uncharacterized protein C23H4.13c (SPAC23H4.13c)

Sign In for Pricing
View Details