Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) spans the amino acid sequence from region 2-141.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7

UniProt

Q0MQB9

Expression Region

2-141

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGQLEGWEVFAKPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details