Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) spans the amino acid sequence from region 2-141.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7

UniProt

Q0MQB9

Expression Region

2-141

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGQLEGWEVFAKPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB14 Recombinant Protein (Human)
RP025417 100 µg

RAB14 Recombinant Protein (Human)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2115159-01 0.1 mL

HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2115159-02 0.2 mL

HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2115159-03 0.5 mL

HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2115159-04 1 mL

HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2115159-05 5 mL

HRP-Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details