Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

This Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) spans the amino acid sequence from region 2-141.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7

UniProt

Q0MQB8

Expression Region

2-141

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGQLEGWEVFAKPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL
BNC881137-500 1x 500 µL

ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1792), CF568 conjugate, 0.1mg/mL
BNC681792-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1792), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1238), CF568 conjugate, 0.1mg/mL
BNC681238-500 1x 500 µL

Napsin-A (NAPSA/1238), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5), CF568 conjugate, 0.1mg/mL
BNC680527-100 1x 100 µL

Nucleolin (364-5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details