Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

This Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) spans the amino acid sequence from region 2-141.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7

UniProt

Q0MQC0

Expression Region

2-141

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGRLEGWEVFAKPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
BNC940806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details