Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

This Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) spans the amino acid sequence from region 2-141.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7

UniProt

Q0MQC0

Expression Region

2-141

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGRLEGWEVFAKPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCP2 Polyclonal Antibody
MBS8525794-01 0.1 mg

UCP2 Polyclonal Antibody

Sign In for Pricing
View Details
UCP2 Polyclonal Antibody
MBS8525794-02 0.1 mL (AF635)

UCP2 Polyclonal Antibody

Sign In for Pricing
View Details
UCP2 Polyclonal Antibody
MBS8525794-03 0.1 mL (AF610)

UCP2 Polyclonal Antibody

Sign In for Pricing
View Details
UCP2 Polyclonal Antibody
MBS8525794-04 0.1 mL (AF405S)

UCP2 Polyclonal Antibody

Sign In for Pricing
View Details
UCP2 Polyclonal Antibody
MBS8525794-05 0.1 mL (AF405L)

UCP2 Polyclonal Antibody

Sign In for Pricing
View Details
UCP2 Polyclonal Antibody
MBS8525794-06 0.1 mL (AF546)

UCP2 Polyclonal Antibody

Sign In for Pricing
View Details