Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q5GXD6

Expression Region

1-140

Origin

Xanthomonas oryzae pv. oryzae

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMVSEFKQFAIRGNVIDLAVGVVIGAAFGKIVTALVEKIIMPPIGWAIGNVDFSRLAWV LKPAGVDATGKDIPAVAIGYGDFINTVVQFVIIAFAIFLLVKLINRVTNRKPDAPKGPSE EVLLLREIRDSLKNDTLKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2965), CF647 conjugate, 0.1mg/mL
BNC472965-500 1x 500 µL

C1QB / Complement C1q B-Chain (C1QB/2965), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF647 conjugate, 0.1mg/mL
BNC471803-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF594 conjugate, 0.1mg/mL
BNC942049-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/2049R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details