Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R495 (MIMI_R495)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R495 (MIMI_R495) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Uncharacterized protein R495

UniProt

Q5UQG5

Expression Region

1-140

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCITTNNVKRLIILIIFVVIIWQFYYYASSKHNNNFLNEKIAIVPHDIKCLFNQPNCSE ADVDGWSLVQAFIYFVVGLIIPNKYLIIIIVSIILEILKPFIGYEPKYIIGPLLNTTGYI VGSMLSPCKNNYKEKYQIFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF568 conjugate, 0.1mg/mL
BNC681469-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF568 conjugate, 0.1mg/mL
BNC682046-100 1x 100 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details