Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 242 (Tmem242)

This Recombinant Mouse Transmembrane protein 242 (Tmem242) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Transmembrane protein 242

UniProt

Q8VCR3

Expression Region

1-140

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METSGPGPGESSELEAPGSPDDRLFLVKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWF NKGTMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMKDFRSKMQSIF PPIPKNHESAEEWEEVLKWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creb3 Mouse Gene Knockout Kit (CRISPR)
KN503806 1 Kit

Creb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CHST5/GST4 Protein (Fc Tag)
PKSM040335 100 µg

Recombinant Mouse CHST5/GST4 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Anti-SARS-CoV-2 Spike RBD antibody (ABMX-003)
10-2006-100 100 µg

Recombinant Anti-SARS-CoV-2 Spike RBD antibody (ABMX-003)

Sign In for Pricing
View Details
ARHGEF4 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
CF812762 100 µg

ARHGEF4 Mouse Monoclonal Antibody [Clone ID: OTI1A6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS710326 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), Biotin conjugate, 0.1mg/mL
BNCB2251-500 1x 500 µL

8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details