Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 242 (Tmem242)

This Recombinant Mouse Transmembrane protein 242 (Tmem242) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Transmembrane protein 242

UniProt

Q8VCR3

Expression Region

1-140

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METSGPGPGESSELEAPGSPDDRLFLVKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWF NKGTMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMKDFRSKMQSIF PPIPKNHESAEEWEEVLKWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD5L Antibody Pair Set
E-KAB-0509 50 µL & 100 µg

Human CD5L Antibody Pair Set

Sign In for Pricing
View Details
Mouse Prss32 activation kit by CRISPRa
GA208334 1 Kit

Mouse Prss32 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC22A7 (NM_006672) Human Over-expression Lysate
LC401997 20 µg

SLC22A7 (NM_006672) Human Over-expression Lysate

Sign In for Pricing
View Details
FLCN Recombinant Rabbit monoclonal Antibody
HA751180 100 µL

FLCN Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS707198 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
Troleandomycin
TRC-T892533-2.5MG 2.5 mg

Troleandomycin

Sign In for Pricing
View Details