Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 242 (Tmem242)

This Recombinant Mouse Transmembrane protein 242 (Tmem242) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Transmembrane protein 242

UniProt

Q8VCR3

Expression Region

1-140

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METSGPGPGESSELEAPGSPDDRLFLVKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWF NKGTMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMKDFRSKMQSIF PPIPKNHESAEEWEEVLKWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Didecyl Phthalate
TRC-D439395-1G 1 g

Didecyl Phthalate

Sign In for Pricing
View Details
DTYMK (NM_001165031) Human Over-expression Lysate
LC431780 20 µg

DTYMK (NM_001165031) Human Over-expression Lysate

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2674), CF405S conjugate, 0.1mg/mL
BNC042674-100 1x 100 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2674), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MVD Polyclonal Antibody
E-AB-40364-01 25 µL

MVD Polyclonal Antibody

Sign In for Pricing
View Details
MVD Polyclonal Antibody
E-AB-40364-02 100 µL

MVD Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 2B6 (CYP2B6) (NM_000767) Human Over-expression Lysate
LY400259 100 µg

Cytochrome P450 2B6 (CYP2B6) (NM_000767) Human Over-expression Lysate

Sign In for Pricing
View Details