Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b (cob)

This Recombinant Cytochrome b (cob) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P56631

Expression Region

1-140

Origin

Aspergillus terreus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALVIMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFVFKDLVTIFIFFIVLSIFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam188a 3'UTR Luciferase Stable Cell Line
TU204330 1.0 mL

Fam188a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mesothelin Recombinant Antibody, Cy7 Conjugated
bsm-60005R-Cy7-TR 20 µL

Mesothelin Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Zkscan8 (NM_001251834) Mouse Untagged Clone
MC225927 10 µg

Zkscan8 (NM_001251834) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase ark1 (ark1)
MBS1196944-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase ark1 (ark1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase ark1 (ark1)
MBS1196944-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase ark1 (ark1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase ark1 (ark1)
MBS1196944-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase ark1 (ark1)

Sign In for Pricing
View Details