Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b (cob)

This Recombinant Cytochrome b (cob) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P56631

Expression Region

1-140

Origin

Aspergillus terreus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALVIMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFVFKDLVTIFIFFIVLSIFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiotrophin-1 Polyclonal Conjugated Antibody
orb1613851 100 µL

Cardiotrophin-1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NUFIP2 CRISPR Knock Out 293T Cell Line (Human)
32311141 1x 10^6 Cells / 1.0 mL

NUFIP2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)
abx317694-01 20 µg

RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)

Sign In for Pricing
View Details
RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)
abx317694-02 50 µg

RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)

Sign In for Pricing
View Details
RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)
abx317694-03 100 µg

RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)

Sign In for Pricing
View Details
RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)
abx317694-04 200 µg

RanBP-Type And C3HC4-Type Zinc Finger-Containing Protein 1 (RBCK1) Antibody (Biotin)

Sign In for Pricing
View Details