Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b (cob)

This Recombinant Cytochrome b (cob) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P56631

Expression Region

1-140

Origin

Aspergillus terreus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALVIMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFVFKDLVTIFIFFIVLSIFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HAdV-4 PVII Protein (aa 25-193)
VAng-Cr4309-1mgEcoli 1 mg (E. coli)

Recombinant HAdV-4 PVII Protein (aa 25-193)

Sign In for Pricing
View Details
POLR2A Protein Vector (Human) (pPB-N-His)
PV032102 500 ng

POLR2A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
HP1 gamma (CBX3) (NM_007276) Human Recombinant Protein
PH32149E1 50 µg

HP1 gamma (CBX3) (NM_007276) Human Recombinant Protein

Sign In for Pricing
View Details
(R, R) -1,2-Bis (4-fluorophenyl) -1,2-ethanediamine dihydrochloride
sc-301642 250 mg

(R, R) -1,2-Bis (4-fluorophenyl) -1,2-ethanediamine dihydrochloride

Sign In for Pricing
View Details
SEC24C Antibody (Rabbit Polyclonal)
MBS8508382-01 0.2 mL

SEC24C Antibody (Rabbit Polyclonal)

Sign In for Pricing
View Details
SEC24C Antibody (Rabbit Polyclonal)
MBS8508382-02 0.1 mL (AF405L)

SEC24C Antibody (Rabbit Polyclonal)

Sign In for Pricing
View Details