Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqxH (yqxH)

This Recombinant Bacillus subtilis Uncharacterized protein yqxH (yqxH) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Uncharacterized protein yqxH, ORF2

UniProt

P24811

Expression Region

1-140

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKAWKFKKLRSRSAWFGY VRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITENLAQIGVKIPSSITDR LQTIENEKEQSKNNADKAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse gamma glutamyl transpeptidase (GGT) ELISA Kit
201-02-0990 96 Tests

Mouse gamma glutamyl transpeptidase (GGT) ELISA Kit

Sign In for Pricing
View Details
PLOD2
488854 100 µL

PLOD2

Sign In for Pricing
View Details
Granulocyte Colony Stimulating Factor (G-CSF) Antibody
abx121610-01 30 µL

Granulocyte Colony Stimulating Factor (G-CSF) Antibody

Sign In for Pricing
View Details
Granulocyte Colony Stimulating Factor (G-CSF) Antibody
abx121610-02 100 µL

Granulocyte Colony Stimulating Factor (G-CSF) Antibody

Sign In for Pricing
View Details
Granulocyte Colony Stimulating Factor (G-CSF) Antibody
abx121610-03 200 µL

Granulocyte Colony Stimulating Factor (G-CSF) Antibody

Sign In for Pricing
View Details
AMBP Antibody
orb1268782 400 μl

AMBP Antibody

Sign In for Pricing
View Details