Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1

This Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1 spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Putative ABC transporter permease protein ORF1

UniProt

P40979

Expression Region

1-140

Origin

Caldicellulosiruptor sp. (strain Rt8B.4)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DPNVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFWRIELPLLT PSIKTACILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAFASFKMGYGSTIASAM FLIITTAGIFAYFVTRRKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-100 1x 100 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details