Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C338.03c (SPCC338.03c)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C338.03c (SPCC338.03c) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C338.03c

UniProt

A6X993

Expression Region

1-141

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVISSVFSAFADIPSVYLISVNCGARELWLTITSIHFVSLREQRYEFLANSLGERTSSLK SQEEMVSVSRNGKQLLSEASFFRLGKHVHLNFLPFENTFEMALRNDFQIFCTSILFTCYI QSFSLLISNFFIAIEVSRSFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc20 (AR12), CF405S conjugate, 0.1mg/mL
BNC040672-500 1x 500 µL

Cdc20 (AR12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF594 conjugate, 0.1mg/mL
BNC940696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL
BNC941683-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/2569R), CF640R conjugate, 0.1mg/mL
BNC402569-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/2569R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details