Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquareovirus G Non-structural protein 5 (S7)

This Recombinant Aquareovirus G Non-structural protein 5 (S7) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Non-structural protein 5, NS5, NS16

UniProt

B2BNE5

Expression Region

1-141

Origin

Aquareovirus G (isolate American grass carp/USA/PB01-155/-) (AQRV-G)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPCQDTVSLSIQHTHVIIQNSCCTTVSTSASTSATAYGLGCLALGCAGIAAAGICICCLI HGCPACPRRLGVRKQSSLSKQGHVSFHHLNPSDRVSRPYHPSCPTDVDLYLGGVQHDPDY VSHAQPIETQPQPLPPPPAYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FineTest®Violet 450 Anti-Mouse CD49b/pan-NK cells Antibody (DX5)
FV450-30097U-01 25 µg

FineTest®Violet 450 Anti-Mouse CD49b/pan-NK cells Antibody (DX5)

Sign In for Pricing
View Details
FineTest®Violet 450 Anti-Mouse CD49b/pan-NK cells Antibody (DX5)
FV450-30097U-02 100 µg

FineTest®Violet 450 Anti-Mouse CD49b/pan-NK cells Antibody (DX5)

Sign In for Pricing
View Details
Mouse High Sensitive Hepcidin (Hepc) CLIA Kit
abx490715-01 96 Tests

Mouse High Sensitive Hepcidin (Hepc) CLIA Kit

Sign In for Pricing
View Details
Mouse High Sensitive Hepcidin (Hepc) CLIA Kit
abx490715-02 5x 96 Tests

Mouse High Sensitive Hepcidin (Hepc) CLIA Kit

Sign In for Pricing
View Details
Mouse High Sensitive Hepcidin (Hepc) CLIA Kit
abx490715-03 10x 96 Tests

Mouse High Sensitive Hepcidin (Hepc) CLIA Kit

Sign In for Pricing
View Details
MIF Rabbit Polyclonal Antibody (APC-Cy7)
orb1609490 100 µL

MIF Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details