Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium chloromethanicum Large-conductance mechanosensitive channel (mscL)

This Recombinant Methylobacterium chloromethanicum Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7KPQ5

Expression Region

1-141

Origin

Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAVTGGLDFSNYYIPLS SKVQDGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNVLKSREEAKPKPVA EVPADVKLLGEIRDLLAARRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-500 1x 500 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details