Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 (AF_1096)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 (AF_1096) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1096

UniProt

O29169

Expression Region

1-141

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRKMDEKGVSPVIGVILMVAITVILAAVIASFVFGMSNVAPAAPPSAQLQVRTGSSAD TVELKHMGGDPINCTSIKVLVNGKEESNALGSSGGCSDNLLKVGETETITLSGYGGQYVE LTLVDIQTNKPILMTHVTVGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC15 3'UTR Luciferase Stable Cell Line
TU027578 1.0 mL

TXNDC15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike Antibody, Rabbit MAb
21804-01 50 µL

SARS-CoV-2 (2019-nCoV) Spike Antibody, Rabbit MAb

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike Antibody, Rabbit MAb
21804-02 100 µL

SARS-CoV-2 (2019-nCoV) Spike Antibody, Rabbit MAb

Sign In for Pricing
View Details
FNDC4 Protein Vector (Human) (pPM-C-His)
PV016552 500 ng

FNDC4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Bovine Membrane IgA ELISA Kit
BG-BVN11596 1 Each

Bovine Membrane IgA ELISA Kit

Sign In for Pricing
View Details
Cullin 4A Rabbit pAb, BF700 conjugated
orb2858022 100 µL

Cullin 4A Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details