Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 (AF_1096)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 (AF_1096) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1096

UniProt

O29169

Expression Region

1-141

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRKMDEKGVSPVIGVILMVAITVILAAVIASFVFGMSNVAPAAPPSAQLQVRTGSSAD TVELKHMGGDPINCTSIKVLVNGKEESNALGSSGGCSDNLLKVGETETITLSGYGGQYVE LTLVDIQTNKPILMTHVTVGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC19A2 Antibody - C-terminal region
ARP63507_P050-25UL 25 µL

SLC19A2 Antibody - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal PGM2 Antibody
NBP2-99596-100ul 100 µL

Rabbit Polyclonal PGM2 Antibody

Sign In for Pricing
View Details
SHC4 Over-expression Lysate Product
GWB-1B8B12 0.1 mg

SHC4 Over-expression Lysate Product

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-5586-3p Vector
mh31966 500 ng

LentimiRa-Off-hsa-miR-5586-3p Vector

Sign In for Pricing
View Details
Human Polycomb Group Ring Finger Protein 4 (PCGF4) ELISA Kit
RDR-PCGF4-Hu-48Tests 48 Tests

Human Polycomb Group Ring Finger Protein 4 (PCGF4) ELISA Kit

Sign In for Pricing
View Details
DEF6 Antibody
R33147-100UG 100 µg

DEF6 Antibody

Sign In for Pricing
View Details