Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Opalin (OPALIN)

This Recombinant Pongo abelii Opalin (OPALIN) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Opalin, Oligodendrocytic myelin paranodal and inner loop protein, Transmembrane protein 10

UniProt

Q5R461

Expression Region

1-141

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPSLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDSPKISENPRRSPTHEKNTMGAQEAHIYVKTAAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit
MBS9904613-01 48 Well

Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit

Sign In for Pricing
View Details
Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit
MBS9904613-02 96 Well

Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit

Sign In for Pricing
View Details
Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit
MBS9904613-03 5x 96 Well

Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit

Sign In for Pricing
View Details
Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit
MBS9904613-04 10x 96 Well

Porcine Eukaryotic Translation Initiation Factor 3 Subunit I (EIF3I) ELISA Kit

Sign In for Pricing
View Details
MYBPC3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
31203064 1.0 µg DNA

MYBPC3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FDX6 Antibody
orb837471 2 mg

FDX6 Antibody

Sign In for Pricing
View Details