Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C1orf115 homolog

This Recombinant Mouse Uncharacterized protein C1orf115 homolog spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Uncharacterized protein C1orf115 homolog

UniProt

Q8BGN9

Expression Region

1-141

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVGARLRSKAASSLVGRRPLGRSRRAGDEETDAIVEHLEGEDEDPASPDCEREEGGRRA GTPSARRVHLAALPERYDSLEEPAPGDKPKKRYRRKLKKYGKNFGKAISKGCRYIVIGLQ GFAAAYSAPFGVATSVVSFVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genistein 4’-beta-D-Glucuronide
TRC-G349990-25MG 25 mg

Genistein 4’-beta-D-Glucuronide

Sign In for Pricing
View Details
PKCB1 Antibody
8C11882-AAT 50 µg

PKCB1 Antibody

Sign In for Pricing
View Details
AMOZ
TRC-A634600-50MG 50 mg

AMOZ

Sign In for Pricing
View Details
Recombinant Human BLyS/TNFSF13B/BAFF Protein
PKSH031909-01 20 µg

Recombinant Human BLyS/TNFSF13B/BAFF Protein

Sign In for Pricing
View Details
Recombinant Human BLyS/TNFSF13B/BAFF Protein
PKSH031909-02 100 µg

Recombinant Human BLyS/TNFSF13B/BAFF Protein

Sign In for Pricing
View Details
Rbp1 Mouse Gene Knockout Kit (CRISPR)
KN514591 1 Kit

Rbp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details