Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C1orf115 homolog

This Recombinant Mouse Uncharacterized protein C1orf115 homolog spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Uncharacterized protein C1orf115 homolog

UniProt

Q8BGN9

Expression Region

1-141

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVGARLRSKAASSLVGRRPLGRSRRAGDEETDAIVEHLEGEDEDPASPDCEREEGGRRA GTPSARRVHLAALPERYDSLEEPAPGDKPKKRYRRKLKKYGKNFGKAISKGCRYIVIGLQ GFAAAYSAPFGVATSVVSFVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MICA Antibody
E55A15949 100 µg

Human MICA Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD53 Antibody (161-2 (53/2)) [Janelia Fluor 549]
NBP3-12076JF549 0.1 mL

Mouse Monoclonal CD53 Antibody (161-2 (53/2)) [Janelia Fluor 549]

Sign In for Pricing
View Details
Ribonuclease 3 (10X9) Rabbit Monoclonal Antibody
E28M3439 100 µL

Ribonuclease 3 (10X9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRXS4 Polyclonal Antibody
MBS7180696 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRXS4 Polyclonal Antibody

Sign In for Pricing
View Details
NMI Recombinant Protein (Mouse)
RP154421 100 µg

NMI Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Tmem185a (NM_001135712) Rat Tagged ORF Clone Lentiviral Particle
RR206601L3V 200 µL

Tmem185a (NM_001135712) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details