Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Opalin (OPALIN)

This Recombinant Human Opalin (OPALIN) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Opalin, Oligodendrocytic myelin paranodal and inner loop protein, Transmembrane protein 10

UniProt

Q96PE5

Expression Region

1-141

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 antibody
63CFB-100T 100 Tests

CD63 antibody

Sign In for Pricing
View Details
Canine C type lectin domain family 18 member A (CLEC18A) ELISA kit
GTR10467728 96 Well

Canine C type lectin domain family 18 member A (CLEC18A) ELISA kit

Sign In for Pricing
View Details
Kif5b Mouse Pre-designed siRNA Set A
HY-RS18287 1 Set

Kif5b Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Tin2 (3G11)
YF-MA18091 100 ug

Anti-Tin2 (3G11)

Sign In for Pricing
View Details
Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H3 (Itih3) Elisa Kit
EKC34182 96 Tests

Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H3 (Itih3) Elisa Kit

Sign In for Pricing
View Details
HP ELISA Kit (Bovine) (OKCD06849)
OKCD06849 96 Well

HP ELISA Kit (Bovine) (OKCD06849)

Sign In for Pricing
View Details