Recombinant Human Opalin (OPALIN)
This Recombinant Human Opalin (OPALIN) spans the amino acid sequence from region 1-141.
Product Specifications
Product Name Alternative
Opalin, Oligodendrocytic myelin paranodal and inner loop protein, Transmembrane protein 10
UniProt
Q96PE5
Expression Region
1-141
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6470747-01 0.2 mL
COPS3, ID (COP9 Signalosome Complex Subunit 3, Signalosome Subunit 3, SGN3, JAB1-containing Signalosome Subunit 3, CSN3) (FITC)
Sign In for Pricing
View Details 
MBS6470747-02 5x 0.2 mL
COPS3, ID (COP9 Signalosome Complex Subunit 3, Signalosome Subunit 3, SGN3, JAB1-containing Signalosome Subunit 3, CSN3) (FITC)
Sign In for Pricing
View Details 
GTR10423311 96 Well
Chicken F box only protein 33 (FBXO33) ELISA kit
Sign In for Pricing
View Details 