Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrophosphate-energized proton pump (hppA)

This Recombinant Pyrophosphate-energized proton pump (hppA) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Pyrophosphate-energized proton pump, EC= 3.6.1.1, Membrane-bound proton-translocating pyrophosphatase, Pyrophosphate-energized inorganic pyrophosphatase, H (+) -PPase

UniProt

Q8VRZ1

Expression Region

1-141

Origin

Anaplasma marginale

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEIGTVAGKSITGTNLFVCGLIGLIVT GLIVVITEYYTGTNKRPVNSXAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIXTYQ LAGLFGTAIAVTAMLGIAGMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS800051 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Susd6 Mouse Gene Knockout Kit (CRISPR)
KN500454 1 Kit

Susd6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LIN28B Human Gene Knockout Kit (CRISPR)
KN213537 1 Kit

LIN28B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TEDC1 (NM_001134875) Human Over-expression Lysate
LY427507 100 µg

TEDC1 (NM_001134875) Human Over-expression Lysate

Sign In for Pricing
View Details
ZP3 Polyclonal Antibody
E-AB-67979-01 60 µL

ZP3 Polyclonal Antibody

Sign In for Pricing
View Details
ZP3 Polyclonal Antibody
E-AB-67979-02 120 µL

ZP3 Polyclonal Antibody

Sign In for Pricing
View Details