Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrophosphate-energized proton pump (hppA)

This Recombinant Pyrophosphate-energized proton pump (hppA) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Pyrophosphate-energized proton pump, EC= 3.6.1.1, Membrane-bound proton-translocating pyrophosphatase, Pyrophosphate-energized inorganic pyrophosphatase, H (+) -PPase

UniProt

Q8VRZ1

Expression Region

1-141

Origin

Anaplasma marginale

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEIGTVAGKSITGTNLFVCGLIGLIVT GLIVVITEYYTGTNKRPVNSXAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIXTYQ LAGLFGTAIAVTAMLGIAGMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Magea4 activation kit by CRISPRa
GA202557 1 Kit

Mouse Magea4 activation kit by CRISPRa

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Succinamic Boc Hydrazido PEG
135000-00-37.1G 1 g

Ɑ-Hydroxy-ω-Succinamic Boc Hydrazido PEG

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF488A conjugate, 0.1mg/mL
BNC880698-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648401 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), 1mg/mL
BNUM0200-50 1x 50 µL

MHC II (HLA-DQ) (SPV-L3), 1mg/mL

Sign In for Pricing
View Details
2-[(1S)-1-Aminoprpyl]-5-fluoro-3-phenyl-4(3H)-quinazolinone
TRC-A628755-1G 1 g

2-[(1S)-1-Aminoprpyl]-5-fluoro-3-phenyl-4(3H)-quinazolinone

Sign In for Pricing
View Details