Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (Ndufa11)
This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (Ndufa11) spans the amino acid sequence from region 1-141.
Product Specifications
Product Name Alternative
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7
UniProt
Q9D8B4
Expression Region
1-141
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVKRFFESYHEVPDGTQCHRKTYITTALGGICGIIGSAYRVSLNPADSTLEAVARVGRYT FTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAMGCVYMGT AAALFKIGKLEGWELFPTPKV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC551037-500 1x 500 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400270-100 1x 100 µL
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402409-500 1x 500 µL
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details