Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL62 (ATL62)

This Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL62 (ATL62) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative RING-H2 finger protein ATL62

UniProt

Q9LJL6

Expression Region

1-141

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDALEAVRSRTFFAILTVFYSIFRCCLAYCNKGDDDHLIHPSHSLHVIKATGINPSVL LSIPVVSFNANAFKDNIECVVCLSKFIDEDKARVLPSCNHCFHFDFTDTWLHSDYTCPNC RKNVEEIQNHELSLSPNPNSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF647 conjugate, 0.1mg/mL
BNC471527-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF568 conjugate, 0.1mg/mL
BNC682284-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF488A conjugate, 0.1mg/mL
BNC880749-500 1x 500 µL

CD8 (C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details