Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 242 (TMEM242)

This Recombinant Human Transmembrane protein 242 (TMEM242) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Transmembrane protein 242

UniProt

Q9NWH2

Expression Region

1-141

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEW FNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSI FPTIPKNSESAVEWEETLKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AXDND1 Human qPCR Primer Pair (NM_144696)
HP217273 200 Reactions

AXDND1 Human qPCR Primer Pair (NM_144696)

Sign In for Pricing
View Details
Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit
MBS7235705-01 48 Well

Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit

Sign In for Pricing
View Details
Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit
MBS7235705-02 96 Well

Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit

Sign In for Pricing
View Details
Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit
MBS7235705-03 5x 96 Well

Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit

Sign In for Pricing
View Details
Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit
MBS7235705-04 10x 96 Well

Monkey Olfactory receptor 10S1 (OR10S1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SLC5A4 Protein, N-His-SUMO
orb3058640-01 50 µg

Recombinant Human SLC5A4 Protein, N-His-SUMO

Sign In for Pricing
View Details