Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013)

This Recombinant Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0010c/MT0013

UniProt

P71580

Expression Region

1-141

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAALGLILFASATWRARPR LAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEIETVSGGLLILSRWDLG TDPVEVLDALTAAGYAGRGQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human IgG (H&L) - AMCA
CSA2521-01 100 µL

Rabbit Anti-Human IgG (H&L) - AMCA

Sign In for Pricing
View Details
Rabbit Anti-Human IgG (H&L) - AMCA
CSA2521-02 500 μL

Rabbit Anti-Human IgG (H&L) - AMCA

Sign In for Pricing
View Details
Rabbit Anti-Human IgG (H&L) - AMCA
CSA2521-03 1 mL

Rabbit Anti-Human IgG (H&L) - AMCA

Sign In for Pricing
View Details
SUPT20H Antibody
OAAN03669-50UL 50 µL

SUPT20H Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal HIF-2 alpha/EPAS1 Antibody (2444A)
NBP2-76454SS 0.025 mg

Rabbit Monoclonal HIF-2 alpha/EPAS1 Antibody (2444A)

Sign In for Pricing
View Details
Rat Monoclonal Syndecan-1/CD138 Antibody (359103R) [DyLight 405]
FAB2780RE 0.1 mL

Rat Monoclonal Syndecan-1/CD138 Antibody (359103R) [DyLight 405]

Sign In for Pricing
View Details