Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013)

This Recombinant Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0010c/MT0013

UniProt

P71580

Expression Region

1-141

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAALGLILFASATWRARPR LAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEIETVSGGLLILSRWDLG TDPVEVLDALTAAGYAGRGQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF770 Rabbit Polyclonal Antibody (Biotin)
orb450389 100 µL

ZNF770 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit
abx516573 96 Tests

Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit

Sign In for Pricing
View Details
THNSL1 Antibody
47367 100 µL

THNSL1 Antibody

Sign In for Pricing
View Details
SACS Rabbit Polyclonal Antibody
E28PN2497 100 µL

SACS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Armc12 shRNA (UAS) - Lentiviral mouse Armc12 shRNA (UAS, iRFP) (100)
GTR15222927 1 Vial

Lentiviral mouse Armc12 shRNA (UAS) - Lentiviral mouse Armc12 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Granzyme A discontinued
536970-01 30ul

Granzyme A discontinued

Sign In for Pricing
View Details