Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative membrane protein mmpS1 (mmpS1)

This Recombinant Putative membrane protein mmpS1 (mmpS1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Putative membrane protein mmpS1

UniProt

P0A5K1

Expression Region

1-142

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVF GPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNE VIREERIVNAYHAHTSCLVKSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nectin 2 antibody
orb69769 100 µL

Nectin 2 antibody

Sign In for Pricing
View Details
RPGRIP1L Antibody - middle region (ARP81404_P050)
ARP81404_P050 100 µL

RPGRIP1L Antibody - middle region (ARP81404_P050)

Sign In for Pricing
View Details
10X Tris-Tricine-SDS buffer
T7789 500 mL

10X Tris-Tricine-SDS buffer

Sign In for Pricing
View Details
Myoglobin
pro-336 10µg

Myoglobin

Sign In for Pricing
View Details
EFR3A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9662R-BF350 100 µL

EFR3A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
GRP78 BiP/HSPA5 Rabbit Polyclonal Antibody (Carrier-free)
orb3081665 100 µg

GRP78 BiP/HSPA5 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details