Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative membrane protein mmpS1 (mmpS1)

This Recombinant Putative membrane protein mmpS1 (mmpS1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Putative membrane protein mmpS1

UniProt

P0A5K0

Expression Region

1-142

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVF GPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNE VIREERIVNAYHAHTSCLVKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC1 (Chloride Intracellular Channel Protein 1, G6, NCC27) (MaxLight 650)
MBS6445730-01 0.1 mL

CLIC1 (Chloride Intracellular Channel Protein 1, G6, NCC27) (MaxLight 650)

Sign In for Pricing
View Details
CLIC1 (Chloride Intracellular Channel Protein 1, G6, NCC27) (MaxLight 650)
MBS6445730-02 5x 0.1 mL

CLIC1 (Chloride Intracellular Channel Protein 1, G6, NCC27) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal Cytochrome P450 Enzyme CYP3A1 Antibody (P6) [PerCP]
NBP3-08767PCP 100 µL

Mouse Monoclonal Cytochrome P450 Enzyme CYP3A1 Antibody (P6) [PerCP]

Sign In for Pricing
View Details
AMPK beta 2 (PRKAB2) Human siRNA Oligo Duplex (Locus ID 5565)
SR303724 1 Kit

AMPK beta 2 (PRKAB2) Human siRNA Oligo Duplex (Locus ID 5565)

Sign In for Pricing
View Details
PSMD4 Antibody, FITC conjugated
A32313-50UL 50 μL

PSMD4 Antibody, FITC conjugated

Sign In for Pricing
View Details
Cyp2j5 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3119202 1.0 µg DNA

Cyp2j5 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details