Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium populi Large-conductance mechanosensitive channel (mscL)

This Recombinant Methylobacterium populi Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B1ZC68

Expression Region

1-142

Origin

Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAITGGLDFSNYYIPLS SKVQAGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNGLKSKEEAKPKPEA EVPADVKLLAEIRDLLAARREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-((4-Fluorophenyl)carbamoyl)cyclopropanecarboxylic Acid
TRC-F632340-500MG 500 mg

1-((4-Fluorophenyl)carbamoyl)cyclopropanecarboxylic Acid

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), CF594 conjugate, 0.1mg/mL
BNC943042-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cholic Acid-d4
TRC-C432603-5MG 5 mg

Cholic Acid-d4

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-608
BMET-608 1 Unit

Multi-parameter Analyzer BMET-608

Sign In for Pricing
View Details
Recombinant Hsp90 beta Antibody
RC-15322-01 50 μL

Recombinant Hsp90 beta Antibody

Sign In for Pricing
View Details
Recombinant Hsp90 beta Antibody
RC-15322-02 100 µL

Recombinant Hsp90 beta Antibody

Sign In for Pricing
View Details