Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium populi Large-conductance mechanosensitive channel (mscL)

This Recombinant Methylobacterium populi Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B1ZC68

Expression Region

1-142

Origin

Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAITGGLDFSNYYIPLS SKVQAGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNGLKSKEEAKPKPEA EVPADVKLLAEIRDLLAARREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd16b Mouse Gene Knockout Kit (CRISPR)
KN500655 1 Kit

Abhd16b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MLH1 Rabbit Polyclonal Antibody
AP20490PU-N 100 µg

MLH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acrosin (ACR) (C-term) Rabbit Polyclonal Antibody
AP50059PU-N 400 µL

Acrosin (ACR) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RON (MST1R) Human Gene Knockout Kit (CRISPR)
KN212786 1 Kit

RON (MST1R) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tubulin α Antibody
8C0379-AAT 50 µg

Tubulin α Antibody

Sign In for Pricing
View Details
Recombinant Human GM2A Protein (Baculovirus, His Tag)
PKSH030677 50 µg

Recombinant Human GM2A Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details