Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 24 (PRR24)

This Recombinant Human Proline-rich protein 24 (PRR24) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Proline-rich protein 24

UniProt

C9JVW0

Expression Region

1-142

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRS PAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDP DRRPSRQTPRETPEAAEGRRPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX10 Mouse Monoclonal Antibody [Clone ID: OTI3F1]
TA808884 100 µL

SNX10 Mouse Monoclonal Antibody [Clone ID: OTI3F1]

Sign In for Pricing
View Details
MIR487b Rat MicroRNA Expression Plasmid (MI0003547)
SC403421 10 µg

MIR487b Rat MicroRNA Expression Plasmid (MI0003547)

Sign In for Pricing
View Details
RFX3, CT (RFX3, Transcription factor RFX3, Regulatory factor X 3) (MaxLight 550)
MBS6341550-01 0.1 mL

RFX3, CT (RFX3, Transcription factor RFX3, Regulatory factor X 3) (MaxLight 550)

Sign In for Pricing
View Details
RFX3, CT (RFX3, Transcription factor RFX3, Regulatory factor X 3) (MaxLight 550)
MBS6341550-02 5x 0.1 mL

RFX3, CT (RFX3, Transcription factor RFX3, Regulatory factor X 3) (MaxLight 550)

Sign In for Pricing
View Details
ACVR2A Knockout HAP1 Polyclonal Cells
ARG34586 1 Million

ACVR2A Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
FDXR Rabbit pAb
A3860-01 100 μL

FDXR Rabbit pAb

Sign In for Pricing
View Details