Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 24 (PRR24)

This Recombinant Human Proline-rich protein 24 (PRR24) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Proline-rich protein 24

UniProt

C9JVW0

Expression Region

1-142

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRS PAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDP DRRPSRQTPRETPEAAEGRRPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytoglobosin D
T75452-01 5 mg

Cytoglobosin D

Sign In for Pricing
View Details
Cytoglobosin D
T75452-02 50 mg

Cytoglobosin D

Sign In for Pricing
View Details
Insect Chorismate Mutase (CM) ELISA Kit
IEK236-01 48 Tests

Insect Chorismate Mutase (CM) ELISA Kit

Sign In for Pricing
View Details
Insect Chorismate Mutase (CM) ELISA Kit
IEK236-02 96 Tests

Insect Chorismate Mutase (CM) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse PRKAG3 Protein, His (Fc)-Avi-tagged
PRKAG3-7089M 50 µg

Recombinant Mouse PRKAG3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Monkey Inhibitor of apoptosis protein Like Protein2 ELISA kit
GTR10441695 96 Well

Monkey Inhibitor of apoptosis protein Like Protein2 ELISA kit

Sign In for Pricing
View Details