Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2122 (AF_2122)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2122 (AF_2122) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2122

UniProt

O28158

Expression Region

1-142

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIAAATDFALNAILRPISDIFVLIYGLLEPINAHLIPEHTNFIYGQLSLLLWGTKFLAT ILGVTANNATAMANFTDVLHTLSENSYHFFGTVEGESGMAYIAKHSYIELSQNQQLSEDM AVKFARAVNSTIIYFVKVFEYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3-(1-Acetyl-4-(2-ethoxy-2-oxoethyl)-1H-pyrrol-3-yl)propanoate
TRC-E679635-500MG 500 mg

Ethyl 3-(1-Acetyl-4-(2-ethoxy-2-oxoethyl)-1H-pyrrol-3-yl)propanoate

Sign In for Pricing
View Details
Vmn2r120 Mouse Gene Knockout Kit (CRISPR)
KN519135 1 Kit

Vmn2r120 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARH3 (ADPRHL2) (NM_017825) Human Recombinant Protein
TP304342 20 µg

ARH3 (ADPRHL2) (NM_017825) Human Recombinant Protein

Sign In for Pricing
View Details
Catharanthine
TRC-C225405-50MG 50 mg

Catharanthine

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104R-01 50 Tests

Elab Fluor® Violet 500 Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104R-02 100 Tests

Elab Fluor® Violet 500 Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details