Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2122 (AF_2122)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2122 (AF_2122) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2122

UniProt

O28158

Expression Region

1-142

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIAAATDFALNAILRPISDIFVLIYGLLEPINAHLIPEHTNFIYGQLSLLLWGTKFLAT ILGVTANNATAMANFTDVLHTLSENSYHFFGTVEGESGMAYIAKHSYIELSQNQQLSEDM AVKFARAVNSTIIYFVKVFEYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ugt8a Mouse Gene Knockout Kit (CRISPR)
KN318683LP 1 Kit

Ugt8a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NED Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*
67010-AAT 1 Plate

NED Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), 0.2mg/mL
BNUB1908-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), 0.2mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2790), CF647 conjugate, 0.1mg/mL
BNC472790-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2790), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATF2 pThr69/51 Rabbit Polyclonal Antibody
AP01530PU-N 100 µg

ATF2 pThr69/51 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sfi1 Mouse Gene Knockout Kit (CRISPR)
KN515648 1 Kit

Sfi1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details