Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein L817

UniProt

Q5UQG8

Expression Region

1-142

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSVNQNTDQHSQDSSSTPNNKLTKTLASLDDSTLEFAVDVLSHLPLIRRSLNYAKNLL VRLFVMYMIVQVSYYIVPFVLLVLFGYNQSTPDMKFAIQLQVLVVSRGIIDGIIGVLQFI FWFWIFVDLIRFLFGYAKNKVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Tumor suppressor candidate 5 homolog (Tusc5)
orb2930563-01 20 µg

Recombinant Mouse Tumor suppressor candidate 5 homolog (Tusc5)

Sign In for Pricing
View Details
Recombinant Mouse Tumor suppressor candidate 5 homolog (Tusc5)
orb2930563-02 100 µg

Recombinant Mouse Tumor suppressor candidate 5 homolog (Tusc5)

Sign In for Pricing
View Details
Amelotin (AMTN) Mouse Monoclonal Antibody [Clone:2B3]
E45M18406 100 µg

Amelotin (AMTN) Mouse Monoclonal Antibody [Clone:2B3]

Sign In for Pricing
View Details
ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)
ARP33515_P050-FITC 100 µL

ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)

Sign In for Pricing
View Details
THEM5, ID (THEM5, Thioesterase superfamily member 5) (Azide free) (HRP) discontinued
042807-HRP 200 µL

THEM5, ID (THEM5, Thioesterase superfamily member 5) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
RBP4 (19-201aa) Monoclonal Antibody
E53M01541 100 µL

RBP4 (19-201aa) Monoclonal Antibody

Sign In for Pricing
View Details