Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein L817

UniProt

Q5UQG8

Expression Region

1-142

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSVNQNTDQHSQDSSSTPNNKLTKTLASLDDSTLEFAVDVLSHLPLIRRSLNYAKNLL VRLFVMYMIVQVSYYIVPFVLLVLFGYNQSTPDMKFAIQLQVLVVSRGIIDGIIGVLQFI FWFWIFVDLIRFLFGYAKNKVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat 3-mercaptopyruvate sulfurtransferase (MPST) ELISA Kit
EK9396 48 Tests

Rat 3-mercaptopyruvate sulfurtransferase (MPST) ELISA Kit

Sign In for Pricing
View Details
Goat Human IgM (μ chain), F (ab) '2 fragment, FITC conjugated Antibody
orb700418 0.5 mg

Goat Human IgM (μ chain), F (ab) '2 fragment, FITC conjugated Antibody

Sign In for Pricing
View Details
Locator 4 PLUS Cryo Vessel
CRY1016 1 Each

Locator 4 PLUS Cryo Vessel

Sign In for Pricing
View Details
USP13 Lentiviral Activation Particles (m2)
sc-428392-LAC-2 200 µL

USP13 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit polyclonal FUS antibody (HRP)
MBS5306125-01 0.1 mg

Rabbit polyclonal FUS antibody (HRP)

Sign In for Pricing
View Details
Rabbit polyclonal FUS antibody (HRP)
MBS5306125-02 5x 0.1 mg

Rabbit polyclonal FUS antibody (HRP)

Sign In for Pricing
View Details