Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L817 (MIMI_L817) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein L817

UniProt

Q5UQG8

Expression Region

1-142

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSVNQNTDQHSQDSSSTPNNKLTKTLASLDDSTLEFAVDVLSHLPLIRRSLNYAKNLL VRLFVMYMIVQVSYYIVPFVLLVLFGYNQSTPDMKFAIQLQVLVVSRGIIDGIIGVLQFI FWFWIFVDLIRFLFGYAKNKVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT12 Antibody
A41995-100UL 100 µL

ACOT12 Antibody

Sign In for Pricing
View Details
CRYAA Rabbit pAb
E45R26047N-50 50 µL

CRYAA Rabbit pAb

Sign In for Pricing
View Details
PROCR (Protein C Receptor, Endothelial Cell Protein C Receptor, CCCA, EPCR, CCD41) (MaxLight 405)
MBS6433233-01 0.1 mL

PROCR (Protein C Receptor, Endothelial Cell Protein C Receptor, CCCA, EPCR, CCD41) (MaxLight 405)

Sign In for Pricing
View Details
PROCR (Protein C Receptor, Endothelial Cell Protein C Receptor, CCCA, EPCR, CCD41) (MaxLight 405)
MBS6433233-02 5x 0.1 mL

PROCR (Protein C Receptor, Endothelial Cell Protein C Receptor, CCCA, EPCR, CCD41) (MaxLight 405)

Sign In for Pricing
View Details
PIN, FLOATING, TUBE, Stainless Steel, 20nL-Slot, 0.457mm Diameter, 17mm Exposed Length, 50.8mm Total Length
FP1S20 1 EACH

PIN, FLOATING, TUBE, Stainless Steel, 20nL-Slot, 0.457mm Diameter, 17mm Exposed Length, 50.8mm Total Length

Sign In for Pricing
View Details
Ryanodine Receptor Calcium Release Channel Antibody (Human) ELISA Kit
OKCA01103-96W 96 Well

Ryanodine Receptor Calcium Release Channel Antibody (Human) ELISA Kit

Sign In for Pricing
View Details