Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213 (MIMI_R213)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213 (MIMI_R213) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein R213

UniProt

Q5UQ28

Expression Region

1-142

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSGRTSYDENTRQLYKLDDNGNFVFVENISLDNYFDLLIDIYRTNDPIDELDCCFKLHD MDTNTNNISDIIKASHSLPVNMGHIDPVFYLGYPVIFIIGVTYFSIIASRKINPSDRLLN EIKEYRLTCQNVYRKKFSINFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF-2 (F2BR-1) HRP
sc-242 HRP 200 µg/mL

ATF-2 (F2BR-1) HRP

Sign In for Pricing
View Details
Cytomegalovirus, Strain AD 169 (CMV) (APC)
MBS6471790-01 0.1 mL

Cytomegalovirus, Strain AD 169 (CMV) (APC)

Sign In for Pricing
View Details
Cytomegalovirus, Strain AD 169 (CMV) (APC)
MBS6471790-02 5x 0.1 mL

Cytomegalovirus, Strain AD 169 (CMV) (APC)

Sign In for Pricing
View Details
Innovative Grade US Origin Hamster Syrian Gold Plasma K3 EDTA 100ml
IGHMSGPLAK3E100ML 100 mL

Innovative Grade US Origin Hamster Syrian Gold Plasma K3 EDTA 100ml

Sign In for Pricing
View Details
Canine HIV-1 p24 core protein (HIV-1 p24) antibody ELISA Kit
MBS2614543-01 48 Strip Well

Canine HIV-1 p24 core protein (HIV-1 p24) antibody ELISA Kit

Sign In for Pricing
View Details
Canine HIV-1 p24 core protein (HIV-1 p24) antibody ELISA Kit
MBS2614543-02 96 Strip Well

Canine HIV-1 p24 core protein (HIV-1 p24) antibody ELISA Kit

Sign In for Pricing
View Details